DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12061 and ECM27

DIOPT Version :9

Sequence 1:NP_001104467.2 Gene:CG12061 / 3354990 FlyBaseID:FBgn0040031 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_012640.4 Gene:ECM27 / 853570 SGDID:S000003867 Length:725 Species:Saccharomyces cerevisiae


Alignment Length:439 Identity:83/439 - (18%)
Similarity:153/439 - (34%) Gaps:157/439 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PNL--MRQKSWIAIVVSTLVSMYLFVILAIVCDDYLVPAMERLCY--TLRMTYDVAGATFL---A 103
            |:|  ..||| |:..:.:::::..|:|..:.|..   |..:.|.|  ||. .|.:.....:   .
Yeast   387 PHLSNFSQKS-ISDAIFSIITVPFFIIFKLSCPQ---PPSDILSYDPTLN-RYSLTTLPIILLFI 446

  Fly   104 ASTSAPELFVNFVGTFVTNGDIGLGTIVGSSVFNILVIAGVCGIFTQPTKLDWWPVTRDTAWYLI 168
            .|.:||.|..:.:...:|   ..||.:|                                  ||.
Yeast   447 QSITAPFLLCSILSVLLT---YHLGYLV----------------------------------YLF 474

  Fly   169 AIASLTYVLWDSLVMWYEAFALLLLYISYVIQLSFDRRI------QNLVRHEHAESELLDEDPMT 227
                       .|::   |.||:||..:::.:::...:.      .|:::.:..:.:||:.    
Yeast   475 -----------PLIL---AMALILLLTAFITKVNLHNKFTLSLDSSNILQEKLQKRKLLER---- 521

  Fly   228 REEEPLKGFRDHVCAKPKTEYNFYQWTWWAIKYPAELMLACTVPSARSIFFLS--MISAILWISL 290
                                                      :.::..|.||:  :|:.|:||||
Yeast   522 ------------------------------------------LNTSIQIIFLAIGIINIIIWISL 544

  Fly   291 ISYLLTWFLTILGYNLNIPDAIMGLTVLAAGTSVPEVASSY-----------------IVSKKGY 338
            ::..|...:.|....|.:..||:|||:.|.|.||.::.|:.                 :.:|...
Yeast   545 LANSLIEMMEIYQKILGLSKAILGLTIFAWGNSVGDLISNISMCRLYKTQTHYQDRVRLATKFFM 609

  Fly   339 GSMAIC------NAIGSNTFDILVCL--------GLPWLLKILIYQQKIDIDSTA--LTITTAML 387
            .|.|.|      |::|...|..||.:        ...|.|:.:..|:...:|:|.  ..|.:.:.
Yeast   610 ISCASCLGGVMLNSMGGIGFSGLVSMLFIGAFNDNEWWFLRKVKLQETSQLDNTLNYKFIVSCVF 674

  Fly   388 VVTAAVLYL------GLLARRFVMG-KTVGYLSIIFYALFLIIACTLEI 429
            ::...:|.|      ..:.||.... |.||......:||..:|...||:
Yeast   675 IILQIILLLLFFGGPNNIKRRLTKEMKLVGISMCGLWALATLINILLEL 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12061NP_001104467.2 TIGR00367 61..422 CDD:273039 74/413 (18%)
Na_Ca_ex 62..199 CDD:279963 25/141 (18%)
Na_Ca_ex 276..424 CDD:279963 46/189 (24%)
ECM27NP_012640.4 ECM27 18..>225 CDD:223604
PLN03151 <544..637 CDD:215604 23/92 (25%)
ECM27 <558..721 CDD:223604 36/162 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.