DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12061 and YDL206W

DIOPT Version :9

Sequence 1:NP_001104467.2 Gene:CG12061 / 3354990 FlyBaseID:FBgn0040031 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_010075.1 Gene:YDL206W / 851321 SGDID:S000002365 Length:762 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:48/207 - (23%)
Similarity:89/207 - (42%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LMLACTVPSARSI--FFLSMISAILWISLI----SYLLTWFLTILGYNL-NIPDAIMGLTVLAAG 321
            :::..::.|..||  |:|..:..|...||:    |..||..|:.:..|: :|.|.:.|:|:||.|
Yeast    19 ILIGYSLSSNGSISEFYLHSVVLIECFSLLGVVTSDCLTPSLSYISSNIFHISDRVSGMTLLALG 83

  Fly   322 TSVPEVASSYIVSKKGYGSMAICNAIGSNTFDILVCLGLPWLLKILIYQQKIDIDSTA------- 379
            .::|::.|:|...|.|..|:||....|...|.:.|.:||...:..:.:|....|::..       
Yeast    84 NALPDITSTYQSMKSGVTSLAIGELFGGIFFLLTVVIGLMGCVATIQFQHDKSIETYTEESFDQN 148

  Fly   380 -----------LTITTAMLVVTAAVLYLGLLARRFVMGKTVGYLSIIFYALFLII----ACTLEI 429
                       :.|.|.||:|:...|..|.|               .|:...:::    .|.:.:
Yeast   149 LSYDRSNYILDVGIFTFMLLVSGTFLADGRL---------------YFWECIVMVLTYCCCAVYL 198

  Fly   430 LLNKEKMCDIQD 441
            :.:.:..|:|.|
Yeast   199 IKSYKYPCEIND 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12061NP_001104467.2 TIGR00367 61..422 CDD:273039 44/182 (24%)
Na_Ca_ex 62..199 CDD:279963
Na_Ca_ex 276..424 CDD:279963 42/176 (24%)
YDL206WNP_010075.1 ECM27 28..>223 CDD:223604 47/198 (24%)
ECM27 <543..757 CDD:223604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I1510
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.