DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12061 and CG34162

DIOPT Version :9

Sequence 1:NP_001104467.2 Gene:CG12061 / 3354990 FlyBaseID:FBgn0040031 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001097149.2 Gene:CG34162 / 5740392 FlyBaseID:FBgn0085191 Length:535 Species:Drosophila melanogaster


Alignment Length:481 Identity:100/481 - (20%)
Similarity:170/481 - (35%) Gaps:153/481 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LVSMYLFV----ILAIVCDDYLVPAMERLCYTLRMTYDVAGATFLAASTSAPELFVNFVGTF--- 119
            |:|.:|.:    :|.:|...:.||.:..|.....||  :.|::||   ...|..||::..:|   
  Fly    62 LISAFLLMVHLSVLFMVTKYFFVPNLATLIEFAPMT--MFGSSFL---LFGPTFFVSYYNSFWEI 121

  Fly   120 --------VTNGDIGLGTIVGSSVFNIL--VIAGVCGIFTQPTKLD---WWP------------- 158
                    :....:....|:|    :||  ::.|...|..|..::|   :|.             
  Fly   122 CNPRKPESICLSPLQFAKIMG----DILRYIVIGFMVICAQGYRVDGITFWSCLSFILTGMVYLY 182

  Fly   159 --VTRDTAWYLIAIASLTYVLWDSLVMWYEAFALLLLYISYVIQLSFDRRIQNLVRHEHAESELL 221
              :.:....||| :|.|..:.:...|..| .|.::||.|..|...:|.|   :.|:.:..:...|
  Fly   183 IVIKKSYNVYLI-VADLYSIKFRVTVFLY-TFLMVLLVIFVVSYANFQR---SKVKSKQTQENFL 242

  Fly   222 DEDPMTREEEPLKGFRDHVCAKPKTEYNFYQWTWW--AIK----------------YPAELMLAC 268
            :.|.           .|.:..|.:.:..|.:...|  |:.                .|:..:||.
  Fly   243 EMDS-----------GDEILGKYQKQMEFSRREIWLKAVNGYRNMADSNVIYRIAMIPSYFVLAN 296

  Fly   269 TVP---------------SARSIFFLSMI------SAILWISLISYLLTWFLTILGY----NLNI 308
            .:|               |...:|||.:|      .|:.|  ||.:|..|.|:||.:    :|..
  Fly   297 FIPVISNDRALIGWNKYTSCLGLFFLPIICLPHGFKAVSW--LIMFLTCWTLSILTFISTHSLRR 359

  Fly   309 PD-----AIMGLTVLAA-----GTSVPEVASSYIVSK------------KGYGSM------AIC- 344
            |:     |::||.|.:.     ...:..:...||..:            .|.|.|      ..| 
  Fly   360 PNNIWIFALLGLIVSSVFINLLSREIENIIYQYISMQFDVMPDVTALVYFGLGEMLSESIVVRCL 424

  Fly   345 --NAIGSNTFDIL-------VCLGLPWLLKILIYQQKIDI---DSTALTITTAMLVVTAAVLYLG 397
              ..:...||.::       :.|..|.|.....|..|..|   .||..||....||::..:|::.
  Fly   425 QQRKMWDATFGVVMSLVTYAIFLAFPLLFFQGCYNNKCSIMVTSSTETTIHFIFLVLSTCLLHVS 489

  Fly   398 LLARRFVMGKTVGYLSIIFYALFLII 423
            |....|       .:|::||.|.|.:
  Fly   490 LSGYEF-------RISLLFYLLVLTV 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12061NP_001104467.2 TIGR00367 61..422 CDD:273039 99/478 (21%)
Na_Ca_ex 62..199 CDD:279963 37/171 (22%)
Na_Ca_ex 276..424 CDD:279963 47/199 (24%)
CG34162NP_001097149.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.