DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12061 and slc8b1

DIOPT Version :9

Sequence 1:NP_001104467.2 Gene:CG12061 / 3354990 FlyBaseID:FBgn0040031 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_021333605.1 Gene:slc8b1 / 560601 ZFINID:ZDB-GENE-130530-900 Length:301 Species:Danio rerio


Alignment Length:190 Identity:51/190 - (26%)
Similarity:93/190 - (48%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PNLMRQKSWIAIVVSTLVSMYLFVILAIVCDDYLVPAMERLCYTLRMTYDVAGATFLAASTSAPE 110
            |:|:.    :||.:..:..::||::|.::..|:..|.:..:..|||:|::|||.||||....||:
Zfish    95 PSLLP----LAITIYVIWLLFLFLVLGLIASDFFCPNLSAIASTLRLTHNVAGVTFLALGNGAPD 155

  Fly   111 LFVNFVG-TFVTNGDIGLGTIVGSSVFNILVIAGVCGI---FTQPTKLDWWPVTRDTAWYLIAIA 171
            :|..... :......:.:|.:.|:.:|...|:||...:   ||..::    |..||..:|:.|:.
Zfish   156 VFSAMAAFSHPQTAGLAIGALFGAGIFVTTVVAGSVALVKPFTVASR----PFLRDVIFYMAAVF 216

  Fly   172 SLTYVLWDSLVMWYEAFALLLLYISYVIQLSFDRRIQNLVRHEHAESELLDEDPMTREEE 231
            ....||:...:...|:...|.:||:||..:.....|.|..:|:      |.|.|.:.:.|
Zfish   217 WTFTVLYKGHISLGESVGYLGMYIAYVFTVILSSYIYNRQKHQ------LTESPQSSDRE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12061NP_001104467.2 TIGR00367 61..422 CDD:273039 47/175 (27%)
Na_Ca_ex 62..199 CDD:279963 39/140 (28%)
Na_Ca_ex 276..424 CDD:279963
slc8b1XP_021333605.1 Na_Ca_ex 66..>246 CDD:332332 44/158 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.