DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12061 and inhbc

DIOPT Version :10

Sequence 1:NP_001104467.2 Gene:CG12061 / 3354990 FlyBaseID:FBgn0040031 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_002939470.1 Gene:inhbc / 100493888 XenbaseID:XB-GENE-494358 Length:367 Species:Xenopus tropicalis


Alignment Length:36 Identity:12/36 - (33%)
Similarity:18/36 - (50%) Gaps:6/36 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 WFLTILGYNLNIPDAIMGLTVL-AAGTSVPEVASSY 331
            |.:...||.:|.   .|||..: .||  .|.:|:|:
 Frog   281 WIIKPEGYQINY---CMGLCPMHIAG--APGMAASF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12061NP_001104467.2 TIGR00367 61..422 CDD:273039 12/36 (33%)
inhbcXP_002939470.1 TGFb_propeptide 41..239 CDD:480997
TGF_beta_INHBC_E 264..367 CDD:381676 12/36 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.