DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and qsm

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:360 Identity:91/360 - (25%)
Similarity:149/360 - (41%) Gaps:79/360 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 VHCKDTRIAVQV-----RTNKPFNGRIYALG----RSETCNIDVINSDA-FRLDLT---MAGQDC 432
            |||.:.::.|.:     .:......:||..|    ..|.|...:..|.| |||.|:   ..|...
  Fly    29 VHCSEDQMRVDIGLPDAESKDQSAPQIYLEGLKGYPDERCQPQIDGSLAVFRLSLSDFYECGVTR 93

  Fly   433 NTQSVTG--VYSNTVVLQHHSVVMTKADKIYKVKC--------------TYDMSSKNITFG---- 477
            ....:||  ||.:.::::     .|...:|..|||              |...||.:.:.|    
  Fly    94 MVNQLTGKKVYYHKIIIE-----STSGKEIVSVKCITTASPAYNVMMNATTGSSSTSTSSGGIHG 153

  Fly   478 -----MMP--IRDPEMIHINSS--PEAPPPRIRILDTRQ-----REVETVRIGDRLNFRIEIPED 528
                 ::|  .::||.:.|.:|  ..||.||:.|..::.     |:: ||:.|..|...|.:.||
  Fly   154 LVKRDVLPAGFQEPEDLEITTSLTKRAPEPRLSIGVSQDGQKFTRDL-TVKSGTPLTMEINLDED 217

  Fly   529 TP--YGIFARSCVAMAKDARTSFKIIDDDGCPTDPTIFPGF-TADGNALQSTYEAFRFTESYGVI 590
            :.  ||:...  .....|..||.:.:...||..||.:|..| |.||:.|.:.::||:|.:|..|.
  Fly   218 SAPVYGLGVN--YLDVTDTHTSSETLIFKGCTVDPYLFENFNTIDGDILSAKFKAFKFPDSSYVQ 280

  Fly   591 FQCNVKYCLGPCEPAVCEWNMDSFESLGRRRRRSIESNDT---------KSEDDMNISQ-EILVL 645
            |:..|..||..|....|..|...|   |||:|....:|..         :.:|...::: |:|.|
  Fly   281 FRATVNVCLDKCLGTQCSNNQVGF---GRRKREISSANKVYEISLAMFLQVQDIEGVNKNEVLQL 342

  Fly   646 DFGDEKREFFKADPST------DFAKDKTVTIIEP 674
            :  ::.||...|:...      :||.::|....:|
  Fly   343 E--EKLRELKLANQRLARNSRGNFAMEQTPASAQP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 68/265 (26%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 71/275 (26%)
Zona_pellucida <200..300 CDD:278526 33/102 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.