DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and zye

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster


Alignment Length:309 Identity:72/309 - (23%)
Similarity:127/309 - (41%) Gaps:56/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GTLDKIDTLP-VSLDTIEDPNLTNLTRNDVNCDKTGTCYDVSVHCKDTRIAVQVRTNKPFNGRIY 403
            |.|:..|:.| ::.||  ..:..::.:.||.||            :.:.:.|:|..::.|.|.||
  Fly    33 GELEFDDSSPRLTRDT--SLSAKHIEKIDVKCD------------QGSGMMVEVEFSEDFEGVIY 83

  Fly   404 ALG--RSETCNIDVINSDAFRLDLTMAGQDCNTQ---SVTGVYSNTVVLQHHSVVMTKADKIYKV 463
            :.|  ....||....:........|:....|.::   ||.....|.:::|....:....|...|:
  Fly    84 SQGYFSDPKCNYVKGDRSGRSFTFTVPYDGCGSKPSCSVCASIENILIIQDDRDIQNSFDIARKI 148

  Fly   464 KCTY-DMSSKNITFGMMPIRDPEMIHINSSPEAP-----------PPRIRILDTRQREVETVRIG 516
            .|:. |...|.:.|....:...|:|.:: :|..|           ||.::.:.      .|:.:|
  Fly   149 SCSRGDEREKTVYFKPFVVDMLEVISVD-TPSGPVECWMEIGTGTPPNVKPIQ------GTLTLG 206

  Fly   517 DRLNFRIEIP-EDTPYGIFARSCVA---MAKDARTS--FKIIDDDGCPTDPTIF---PGFTADGN 572
            ..:.|.|.:. .:..:.|....|.|   |..:|||:  .::.|..||.....||   ..|.| |:
  Fly   207 TDITFTINVKHSEQAWDINILQCYASDDMDFEARTTKRLQLSDKRGCSIKEKIFGEWRKFEA-GS 270

  Fly   573 ALQSTY----EAFRFTESYGVIFQCNVKYCLGPCEPAVCEWNMDSFESL 617
            :|.|||    :||||.:...|..:|:::.|.|.|:.   ::...|..||
  Fly   271 SLTSTYYNTLKAFRFPDRSQVYLKCDIELCNGACKR---DYTCGSLRSL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 56/245 (23%)
zyeNP_649220.1 ZP 61..313 CDD:214579 61/274 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.