DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and T01D1.8

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001300591.1 Gene:T01D1.8 / 3896729 WormBaseID:WBGene00044641 Length:189 Species:Caenorhabditis elegans


Alignment Length:192 Identity:41/192 - (21%)
Similarity:63/192 - (32%) Gaps:78/192 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 HHS------VVMTK---ADKIY-KVKCTYDMSSKNITFGMMPIRDPEMIHINSSPEAPPPRIRIL 503
            ||.      :|.:|   .|:|| ...|.|....||..|.:|         :|:        ..|.
 Worm    56 HHGSDKLGRIVTSKVNIGDEIYHSWNCNYSGDHKNYLFCVM---------VNN--------CTIS 103

  Fly   504 DTRQREVETVRIGDRLNFRIEIPEDTPYGIFARSCVAMAKDARTSFKIIDDDGCPTDPTIFPGFT 568
            |:.:.|:.|.:|                                  :|||::||...|.|.|..:
 Worm   104 DSGEEEIGTRKI----------------------------------QIIDENGCSVFPNILPDIS 134

  Fly   569 ADGNALQSTYEAFRF---TESYGVIFQCNVKYCL---GPCEPAVCEWNMDSFESLGRRRRRS 624
            ..|: |.:..:...|   .::..|.|.||:|...   ..|:...|          |.:||.|
 Worm   135 YQGD-LSAGIKVHAFALDVDTTAVHFTCNIKMLFKDHEQCQRPRC----------GNQRRFS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 35/161 (22%)
T01D1.8NP_001300591.1 Zona_pellucida <39..179 CDD:391783 37/184 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.