DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and cutl-8

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001250721.1 Gene:cutl-8 / 3565740 WormBaseID:WBGene00013960 Length:625 Species:Caenorhabditis elegans


Alignment Length:289 Identity:83/289 - (28%)
Similarity:125/289 - (43%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 VHCKDTRIAVQVRTNKPFNGRIYALGRS--ETCNIDVINSDAFR---LDLTMAGQDCNTQSVTGV 440
            :.|.:..|.:.|:|.|.|.|||||.||:  |.|..|...:...|   .||....  |..:|:..|
 Worm    32 IECLEDEIRIWVKTRKIFAGRIYAKGRAELEDCYKDDFGNQKTRKPHFDLQFGA--CGMKSLRSV 94

  Fly   441 ------YSNTVVLQHHSVVMTKADKIYKVKCTYDMSSKNIT----FGMMPIRDPEMIH------- 488
                  |..|||:..|.:.:||.|:.|.|||.::.::|.:|    ..|:|..:.|..|       
 Worm    95 DPRGMYYGITVVVSFHPLFITKVDQAYHVKCFFEEANKGLTAELGVSMIPTTELEARHGIPGCTY 159

  Fly   489 -INSSPEAPPPRIRILDTRQ---REVETVRIGDRLNFRIEIPEDTPYGIFARSCV---AMAKDAR 546
             |:.|      .|..||..:   ..::..|:|:|:..:... .|..||:...:|.   ...|.| 
 Worm   160 SIHRS------TIDELDAGRPAGNVIQFARVGERVLHQWHC-NDQMYGVLINNCYVTDGFGKKA- 216

  Fly   547 TSFKIIDDDGCPTDPTIFPG--FTADGNALQSTY---EAFRFTESYGVIFQCNVKYCL---GPCE 603
               .:|||.|||.||.:..|  :::|   ||..|   ..|:|.:..||.|.|.|:.|:   |.|:
 Worm   217 ---DVIDDKGCPIDPILITGIRYSSD---LQRAYAESSVFKFADKPGVWFFCQVQMCMKKHGMCD 275

  Fly   604 ---PAVCEWNMDSFESLGRRRRRSIESND 629
               |..| .:|....|:|.......|..:
 Worm   276 GITPPSC-GSMSRVISVGGEDNGGFEEEE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 74/249 (30%)
cutl-8NP_001250721.1 ZP 33..285 CDD:214579 79/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D200714at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.