DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and COL6A5

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001265227.1 Gene:COL6A5 / 256076 HGNCID:26674 Length:2614 Species:Homo sapiens


Alignment Length:468 Identity:89/468 - (19%)
Similarity:155/468 - (33%) Gaps:161/468 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QLRSENVCHRPWSFERVPNKVIRGLDNALIYTSTKEACLSACLNERR--FVCRSVEYDYNNMKCV 184
            ||..:|  |...||:::..:...|  .||::|:......:..|.:.:  ||..:.| :|...:.|
Human  2038 QLLMKN--HIQTSFQQLNGEATIG--RALLWTTENLFPETPYLRKHKVIFVVSAGE-NYERKEFV 2097

  Fly   185 LSDSDRRSSGQFVQLVDAQGT---DYFENLCLKPAQACKNNRSFGNSQKMGVSEEKVAQYV---- 242
            ...:.|.....:|..|.:.|:   |..|.|...|..  ::....|...|..::  .:|:::    
Human  2098 KMMALRAKCQGYVIFVISLGSTRKDDMEELASYPLD--QHLIQLGRIHKPDLN--YIAKFLKPFL 2158

  Fly   243 -----GLHYYTDKELQVTSESACRL---------------ACEIESEFLCRSFLYLGQ------- 280
                 |.:.|....|    |.||||               ..|::.:||..:. ::||       
Human  2159 YSVRRGFNQYPPPML----EDACRLINLGGENIQNDGFQFVTELQEDFLGGNG-FIGQELNSGRE 2218

  Fly   281 -------PQGSQYNCRL-------------YHLDHK-----TLPDGPSTYLNHERP--------- 311
                   ..||.|...|             |..|.|     :|..|...|...|.|         
Human  2219 SPFVKTEDNGSDYLVYLPSQMFEPQKLMINYEKDQKSAEIASLTSGHENYGRKEEPDHTYEPGDV 2283

  Fly   312 -----------LIDHGEPIG---------------QYF--------ENQCEKAAGLGAGSPPGTL 342
                       |||..:.:|               .||        ....::.|.| :.||||.:
Human  2284 SLQEYYMDVAFLIDASQRVGSDEFKEVKAFITSVLDYFHIAPTPLTSTLGDRVAVL-SYSPPGYM 2347

  Fly   343 DKIDTLPVSLDTIEDPNLTNLTRNDVNCDKTGTCYDVSVHCKDTR---------IAVQVRTNKPF 398
            ...:..||.|:      ...:|.|.:        :.:..|.:|::         .|:|...:..|
Human  2348 PNTEECPVYLE------FDLVTYNSI--------HQMKHHLQDSQQLNGDVFIGHALQWTIDNVF 2398

  Fly   399 NGR--------IYALGRSETCNI--DVINSDAFR-------LDLTMAGQDCNTQSVTGVYSNTVV 446
            .|.        |:.:...||.::  ||:.:.:.|       :.:...|...|.:.:..:.|:.  
Human  2399 VGTPNLRKNKVIFVISAGETNSLDKDVLRNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHP-- 2461

  Fly   447 LQHHSVVMTKADK 459
            |.||.|.:.:..|
Human  2462 LDHHLVQLGRTHK 2474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532 17/83 (20%)
PAN_1 236..327 CDD:394981 32/189 (17%)
ZP 382..598 CDD:214579 20/104 (19%)
COL6A5NP_001265227.1 Nonhelical region 19..1394
vWFA 29..195 CDD:294047
VWA 236..404 CDD:278519
vWA_collagen 441..590 CDD:238749
YfbK 445..>593 CDD:225187
vWA_collagen 627..787 CDD:238749
YfbK 813..>980 CDD:225187
VWA 814..985 CDD:278519
VWA 1005..1172 CDD:278519
Collagen 1394..1447 CDD:189968
Triple-helical region 1395..1728
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1404..1693
Cell attachment site. /evidence=ECO:0000255 1430..1432
Collagen 1443..1520 CDD:189968
Collagen 1485..1576 CDD:189968
Collagen 1564..1623 CDD:189968
Collagen 1597..1657 CDD:189968
Collagen 1645..1730 CDD:189968
VWA 1759..1918 CDD:278519
vWFA_subfamily_ECM 1962..2137 CDD:238727 24/105 (23%)
vWFA_subfamily_ECM 2290..2467 CDD:238727 35/193 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.