DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and F52C9.5

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001367876.1 Gene:F52C9.5 / 186097 WormBaseID:WBGene00018675 Length:645 Species:Caenorhabditis elegans


Alignment Length:182 Identity:42/182 - (23%)
Similarity:72/182 - (39%) Gaps:37/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ADCQAAAFSFVVNPLSPSQETHCQLQNDSSAA--NPSAAP-------QRSANMYYMIKLQLRSEN 127
            |:|..|.....:|.::...::...|.:.|:.|  :.:|.|       ||....|:        |.
 Worm   311 AECAKACIENKINGVALKCKSFDFLSSTSTCAFTSEAAVPVGNGQLKQREDASYH--------EK 367

  Fly   128 VC-------HRPWS-FERVPNKVIRGLDNALIYTSTKEACLSACLNERR---FVCRSVEY--DYN 179
            :|       ..|.: |.|.|..::.|...::..:.:.|.|...|||..:   |.|.|..|  :.|
 Worm   368 ICVSKSFVESCPSTFFSRHPQMILVGFAESVSDSPSFEHCFDTCLNSYQLFGFNCTSGMYYFEEN 432

  Fly   180 NMKCVLSDSDRRSSGQFVQLVDAQGTDYFENLCLKPAQACKNNRSFGNSQKM 231
            .:.|:|:..:|.:..:.....:....||||..|..|       ||..:.:||
 Worm   433 QLNCILNSENRNTQRELFTEENTDIVDYFEVECTTP-------RSKQSKRKM 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052 4/24 (17%)
PAN_AP_HGF 131..210 CDD:238532 21/84 (25%)
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579
F52C9.5NP_001367876.1 PAN_AP 132..213 CDD:214680
PAN_1 287..369 CDD:394981 13/65 (20%)
PAN_AP_HGF 383..462 CDD:238532 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.