DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and cutl-14

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_492780.2 Gene:cutl-14 / 182018 WormBaseID:WBGene00015231 Length:270 Species:Caenorhabditis elegans


Alignment Length:279 Identity:72/279 - (25%)
Similarity:115/279 - (41%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 PGTL---DKIDTLPVSLDTIEDPNLTNLTRNDVNCDKTGTCYDVSVHCKDTRIAVQVRTNKPFNG 400
            ||.|   .:|..:|:       ||              |...:|.|.|.||.|.....|...|.|
 Worm     7 PGFLLFFHQISAIPI-------PN--------------GLLGNVEVECTDTTIEAVFLTETNFLG 50

  Fly   401 RIYALGRSETCNIDVINSDAFR--LDLTMAGQDCNTQSV-----TGVYSN-TVVLQHHSVVMTKA 457
            |::.||.|:  :.|.::.:..|  ..:|:....|..::|     .|..|: .:|:..|...:||.
 Worm    51 RVFVLGHSQ--DKDCVSRETGRRTTSITVPRDKCGVETVQHGKGAGYTSSVNIVISFHDKFLTKV 113

  Fly   458 DKIYKVKCTY----DMSSKNITFGMMPIRDPEMIHINSSPEAPPPRIRILDTR-QREVETVRIGD 517
            |:.|.:.|.|    |:.|..:|.....::|.:::     .|.|.....:.|.| :|..|.|.:..
 Worm   114 DRAYNITCLYAPTGDVVSYALTVQPSLLKDIQVL-----AEQPSCEYEVFDVRTRRPAEIVHVNA 173

  Fly   518 RLNFRIEIPEDTPYGIF---ARSCVAMAKDARTSFKIIDDDGCPTDPTIFPGFTADGNALQSTY- 578
            .|. .:...:.|...:|   ...||.....::...||||.:||..|.|..|....:.|.|.:.. 
 Worm   174 PLE-HVWTCDGTNLDLFCMTVHDCVINEGKSKRRSKIIDSEGCSLDTTRLPNLRYENNKLSARVM 237

  Fly   579 -EAFRFTESYGVIFQCNVK 596
             :||||.:...|.|:|||:
 Worm   238 SKAFRFGDDVAVEFECNVR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 62/233 (27%)
cutl-14NP_492780.2 ZP 32..270 CDD:214579 62/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.