DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and ZC449.1

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_508855.1 Gene:ZC449.1 / 180775 WormBaseID:WBGene00022611 Length:454 Species:Caenorhabditis elegans


Alignment Length:306 Identity:60/306 - (19%)
Similarity:109/306 - (35%) Gaps:95/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RSANMYYMIKLQLRSENVCHRPWSFERVPNKVIRGLD--NALIYTSTKEA-CLSACLNER----- 167
            ::::.||::                  |.|:::..:.  :..:|...::. |...|...:     
 Worm   213 KTSSGYYVV------------------VGNEIVLPISGGDVQVYNEVEQGDCAKYCSENKGPDGS 259

  Fly   168 RFVCRSVEYDYNNMKCVLSD--SDRRSSGQFVQLVDAQGTDYFENLCLKPAQ-ACKNNRSFGNSQ 229
            ...|||:.|.....||.|..  ::...||   :|::.:...|.|..||..:. .|:|:..|    
 Worm   260 TINCRSLNYFPVEKKCELYGILAEPHGSG---KLLENEKVIYAEKFCLPESPFVCQNDEIF---- 317

  Fly   230 KMGVSEEKVAQYVGLHYYTDKELQVTSESA-----CRLACEIESEFLCRSFLYLGQPQGSQYNCR 289
                       .:.:.....|..::|:::|     |...|..:.:  |||.:|:...:    .|.
 Worm   318 -----------ILHVQKTLSKRRRITTKAASSITDCLRKCLEQDD--CRSSVYISNSK----KCE 365

  Fly   290 LYHLDHKTLPDGPSTYL---NHERPLIDHGEPIGQYFENQCEKAAGLGAGSPPGTLDKIDTLPVS 351
            |:::|..|     ..|.   :.|..||          ||.|.:     .|..|...|. .:|...
 Worm   366 LHNVDVST-----GDYARDSDRETVLI----------ENGCRR-----KGVTPKRKDS-PSLSSI 409

  Fly   352 LDTIEDPNLTNLTRND--VNCDKTGTCYDVSVHCKDTRIAVQVRTN 395
            |||....:.::...|.  ..||     |.::..      .|:||||
 Worm   410 LDTSSSESESSSPSNGGWSECD-----YKINGE------TVRVRTN 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532 16/88 (18%)
PAN_1 236..327 CDD:394981 19/98 (19%)
ZP 382..598 CDD:214579 5/14 (36%)
ZC449.1NP_508855.1 PAN_AP 21..105 CDD:214680
PAN_1 230..303 CDD:278453 15/75 (20%)
PAN_1 317..391 CDD:278453 20/109 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.