DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and cutl-26

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_741299.2 Gene:cutl-26 / 176896 WormBaseID:WBGene00021950 Length:502 Species:Caenorhabditis elegans


Alignment Length:265 Identity:67/265 - (25%)
Similarity:108/265 - (40%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 DVSVHCKDTRIAVQVRTNKPFNGRIYA-LGRSETCNIDVINSDAFRLDLTMAGQDCNTQ--SVTG 439
            ||...|.:..::|.:||:|||.|.:.. ...||.|.:....::...|.|.:...:|..:  ..:.
 Worm    28 DVRWSCSEDVVSVFIRTSKPFEGLVQTRSSESEACRVQGFGTNVAVLKLNLKSDECGIKYDVASK 92

  Fly   440 VYSNTVVLQHHSVVMTKADKIYKVKCTYDMSSKNITFGMMPIRDPEMIHINS--SPEAPPPRIRI 502
            .||.||.:..|.|::.:.||...|.|      :.|..|..        |..|  :.::...::|:
 Worm    93 TYSVTVDVHSHPVLIVEGDKSVNVTC------REIANGTQ--------HYASQMTSQSSDYQLRV 143

  Fly   503 LDTRQREVETVRIGDRLNFRIE-IP--EDTPYGIFARSCVAMAKDARTSFKIIDDDGCPTDPTIF 564
            |.:| ..|:||:.......:|. :|  :...|..|...|:|.......:.::.|..||....:|.
 Worm   144 LSSR-LPVDTVKYSQPYTLQIRPLPSTQQNSYSFFVGQCIAQPVGGNVTVQLTDPVGCALFKSIM 207

  Fly   565 PGFTADGNALQSTYEA-----FRFTESYGVIFQCNVKYCLGPCEPAVCEWNMDSFESLGRRRRRS 624
            ..|.    ..:|..||     |||..:..:...|.|..|.|.||...|:.: .|..||..|...|
 Worm   208 GHFA----RRESVEEAEIPSMFRFPNAKQLKISCIVTECDGSCEARTCDQD-SSASSLLERTTAS 267

  Fly   625 IESND 629
            .||.:
 Worm   268 AESEE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 53/228 (23%)
cutl-26NP_741299.2 Zona_pellucida 33..252 CDD:391783 57/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.