DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and Matn3

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_034900.4 Gene:Matn3 / 17182 MGIID:1328350 Length:481 Species:Mus musculus


Alignment Length:403 Identity:71/403 - (17%)
Similarity:113/403 - (28%) Gaps:173/403 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RGPLLLCAVMVVLVT---LPEQIN-----AR---------------------MAFEKLTDFDFPG 50
            |||:.....:.::||   ..:|:|     ||                     ||.:.|.:..|..
Mouse   176 RGPMSNIPKVAIIVTDGRPQDQVNEVAARARASGIELYAVGVDRADMESLKMMASKPLEEHVFYV 240

  Fly    51 NTYYSVKNLS----------------LYECQGWCREEADCQAAAFSFVVNPLSPSQETHCQLQND 99
            .||..::.||                .::||..|..:.|                .:.||:    
Mouse   241 ETYGVIEKLSARFQETFCALDQCMLGTHQCQHVCVSDGD----------------GKHHCE---- 285

  Fly   100 SSAANPSAAPQRSANMYYMIKLQLRSENVCHRPWSFERVPNKVIRGLDNALIYTSTKEACLSACL 164
                                         |.:.::. ....|....:|...:.|   ..|...|:
Mouse   286 -----------------------------CSQGYTL-NADGKTCSAIDKCALST---HGCEQICV 317

  Fly   165 NERR--FVCRSV-EYDYNNMKCVLSDSDRRSSGQFVQLVDAQGTDYFENLCLKPAQACKNNRSFG 226
            |:|.  :.|... .|..|        :|||:.....:.  |.||...:::|:..           
Mouse   318 NDRNGSYHCECYGGYALN--------ADRRTCAALDKC--ASGTHGCQHICVND----------- 361

  Fly   227 NSQKMGVSEEKVAQYVGLHYYTDKELQVTSESACRLACEIESEFLCRSFLYLGQPQGSQYNC--- 288
                 |........:.|.....||:           .|.:.::  |.    || ..|.|:.|   
Mouse   362 -----GAGSHHCECFEGYTLNADKK-----------TCSVRNK--CA----LG-THGCQHICVSD 403

  Fly   289 --RLYHLD---HKTLPDGPSTY--LNHERPLIDHGEPIGQYFENQCEKAAGLGAGSPPGTLDKID 346
              ..||.|   ..||.|...|.  :...|.||.        .|:.|      |.|:.....:|:.
Mouse   404 GAVAYHCDCFPGYTLNDDKKTCSDIEEARSLIS--------IEDAC------GCGATLAFQEKVS 454

  Fly   347 T----LPVSLDTI 355
            :    |...||.|
Mouse   455 SHLQKLNTKLDNI 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052 11/66 (17%)
PAN_AP_HGF 131..210 CDD:238532 16/81 (20%)
PAN_1 236..327 CDD:394981 21/100 (21%)
ZP 382..598 CDD:214579
Matn3NP_034900.4 vWFA 75..298 CDD:294047 24/171 (14%)
FXa_inhibition 305..341 CDD:291342 11/46 (24%)
FXa_inhibition 347..383 CDD:291342 8/64 (13%)
FXa_inhibition 389..425 CDD:291342 12/40 (30%)
Matrilin_ccoil 438..478 CDD:287378 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.