DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and AgaP_AGAP005350

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_315362.4 Gene:AgaP_AGAP005350 / 1276057 VectorBaseID:AGAP005350 Length:398 Species:Anopheles gambiae


Alignment Length:277 Identity:73/277 - (26%)
Similarity:108/277 - (38%) Gaps:68/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 NSDAFRLDLTMAGQDCNTQSVTGVYSNTVVLQHHSVVMTKAD---KIYKVKCTYDMSSKNITFGM 478
            |...|.|.||.. .||....|....:...|..|..:|.|..|   :|..|||.....|.|:|.|:
Mosquito    37 NLAVFELSLTNI-YDCGVTRVINQITGKKVFYHRIIVETGPDTGKEIVSVKCITTGPSYNVTHGI 100

  Fly   479 MP-------IRDPEMIHINSS--PEAPPPRIRILDTRQREVETVRIGDRL-----------NFRI 523
            :.       .::||.:.|.:|  ..||.|.:.|         .:|.||:|           :.::
Mosquito   101 VKRDVLPAGFQEPEDLEITTSITENAPEPSLGI---------AIRQGDKLVSGDLNVSPGAHLQM 156

  Fly   524 EIPEDTP----YGIFARSCVAMAKDARTSFKIIDDDGCPTDPTIFPGF-TADGNALQSTYEAFRF 583
            ||..|..    ||:...  ..:..|.:...:.|..:||..||.:|..| |.||:.|.:.:.||:|
Mosquito   157 EIFLDNRSAPIYGLGVN--YMLVTDTKYQEETIIFNGCSVDPYLFENFNTVDGDLLAAKFRAFKF 219

  Fly   584 TESYGVIFQCNVKYCLGPCEPAVCEWNMDSFESLGRRRRR----------------------SIE 626
            .||..|.|:..|..|:..|:..:|.....:|   |||:|.                      :.:
Mosquito   220 PESTYVQFRGTVNVCVDRCKGVICSNGQTAF---GRRKREISAAPADPNKVYEVTMTTFIKVNYD 281

  Fly   627 SN---DTKSEDDMNISQ 640
            .|   :|.||.|..|.|
Mosquito   282 ENADQNTVSEIDQKIRQ 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 58/208 (28%)
AgaP_AGAP005350XP_315362.4 ZP 4..244 CDD:214579 60/218 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.