DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and AgaP_AGAP000786

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_311326.5 Gene:AgaP_AGAP000786 / 1272378 VectorBaseID:AGAP000786 Length:655 Species:Anopheles gambiae


Alignment Length:365 Identity:76/365 - (20%)
Similarity:130/365 - (35%) Gaps:109/365 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 IEDPN-LTNLTRNDVNCDKTGTCYDVSVHCKDTRIAVQVRTNKPFNGRIYALGR-SETCNIDVIN 417
            :|.|: :.::|..:|.|.|             ..:.|.:..:.||.|.:.:.|: |:...|.|..
Mosquito    37 VERPDGMPSITALEVMCGK-------------DHMDVHLSFSAPFEGIVSSKGQHSDPRCIYVPP 88

  Fly   418 SD-----AFRLDLTMAG--QDCNTQSVTGVYSNTVVLQHHSVVMTKADKIYKVKCTYDMSSKNIT 475
            |.     .||:..:..|  .|.|.|    .|.||||:|:...::...|:..:::|.:        
Mosquito    89 STGKTFFTFRISYSRCGTKPDLNGQ----FYENTVVVQYDKDLLEVWDEAKRLRCEW-------- 141

  Fly   476 FGMMPIRDPEMIHINSSPEAPPPRIRILDTRQREVETVRIGDRLNFRIEIPED-----------T 529
                 ..|.|     .:...||..|..||..|.:..    ||.::..:||.:.           .
Mosquito   142 -----FNDYE-----KTASKPPMVIADLDVIQLDFR----GDNVDCWMEIQQGKGPWAPAVSGIV 192

  Fly   530 PYG-----------------IFARSCVAMAKDARTSFKIIDDDGCPTDPTIFPGF----TADGNA 573
            |.|                 :..:|||| :..|....|:.|:.||...|.:...|    ..|..|
Mosquito   193 PLGSTMTLVVAINDFRGEFDMRVKSCVA-SDGAGHVIKLSDEYGCVLRPKMISRFLKARAPDDKA 256

  Fly   574 LQSTY---EAFRFTESYGVIFQCNVKYCLGPCEPAVCEWNMDSFESLG--------------RRR 621
            ...||   .||:|.::..|..:|.|:.|...|        :|..:..|              .::
Mosquito   257 SVITYAFFHAFKFPDALSVHIKCKVEICRHGC--------LDHCQHSGAPVGAGPAGVPGSAAKQ 313

  Fly   622 RRSIESNDT---KSEDDMNISQEILVLDFGDEKREFFKAD 658
            ...:|..||   ::.:|:.....:..||.|...::.:..|
Mosquito   314 HDLLERKDTLVNQNSNDILAGDSVEDLDSGMNGQDVYYDD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 58/258 (22%)
AgaP_AGAP000786XP_311326.5 ZP 53..284 CDD:214579 60/270 (22%)
Zona_pellucida <192..285 CDD:278526 23/93 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X161
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.