DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tyn and matn3

DIOPT Version :9

Sequence 1:NP_001027032.1 Gene:tyn / 3354987 FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_017949551.2 Gene:matn3 / 101731756 XenbaseID:XB-GENE-985172 Length:402 Species:Xenopus tropicalis


Alignment Length:201 Identity:40/201 - (19%)
Similarity:68/201 - (33%) Gaps:62/201 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 TGVYSNTV-VLQHHSVVMTKADKIYKVKCTYDMSSKNITFGMMPIRDPEMIHINSSPEAPPPRIR 501
            ||.|:..| |:.:.|.|.|   :.|......:...|.....:.|:....|..:            
 Frog   122 TGEYATRVAVVNYASTVKT---EFYLNTYFNNAEMKKAVSMISPLSTGTMTGL------------ 171

  Fly   502 ILDTRQREVETVRIGDR---LNF-RIEI------PEDTPYGIFARS--------CVAMAKDARTS 548
            .:.|...||.|.:.|.|   |.. ::.|      |:|....:.||:        .|.:.:....|
 Frog   172 AIQTAIEEVFTEKAGSRRAALGIPKVAIIVTDGRPQDRVQDVAARARAMNIEIYAVGVDRADMKS 236

  Fly   549 FKIIDDDGCPTDPTIFPGFTADGNALQSTYEAFRFTESYGVIFQCNVKYCLGPCEPAVCEWNMDS 613
            .:::..:  |.|..:|                  :.|:||||.:..:|:....|....|      
 Frog   237 LRLMASE--PLDDHVF------------------YVETYGVIEKLTLKFRESLCGIDAC------ 275

  Fly   614 FESLGR 619
              |:||
 Frog   276 --SMGR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tynNP_001027032.1 PAN_4 46..97 CDD:405052
PAN_AP_HGF 131..210 CDD:238532
PAN_1 236..327 CDD:394981
ZP 382..598 CDD:214579 35/178 (20%)
matn3XP_017949551.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.