DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED21 and MED21

DIOPT Version :9

Sequence 1:NP_001015223.1 Gene:MED21 / 3354977 FlyBaseID:FBgn0040020 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_004255.2 Gene:MED21 / 9412 HGNCID:11473 Length:144 Species:Homo sapiens


Alignment Length:135 Identity:78/135 - (57%)
Similarity:95/135 - (70%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADRLTQLQDTVNQQAEHFCNAIGVIQQTSLPSKFVNFERIGPQTPI----PCPPQEDYAQLFAQ 61
            ||||||||||.||..|:.|||||||:||...|:.|.|.     ||.|    |..|.|:||||||.
Human     1 MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNI-----QTAINKDQPANPTEEYAQLFAA 60

  Fly    62 LIARCAKDIDTLIESLPNEDSSIELQNSSLKRLEIENQGTARDLEEVVQKGELLLEKMQYSLECI 126
            ||||.|||||.||:|||:|:|:..||.:||.:||.||...|..||:||.:|::||||:|.:|..|
Human    61 LIARTAKDIDVLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADI 125

  Fly   127 AQAQL 131
            ||:||
Human   126 AQSQL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED21NP_001015223.1 Med21 1..128 CDD:288119 74/130 (57%)
MED21NP_004255.2 Med21 1..127 CDD:402689 73/129 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157864
Domainoid 1 1.000 130 1.000 Domainoid score I5227
eggNOG 1 0.900 - - E1_KOG1510
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3148
Inparanoid 1 1.050 136 1.000 Inparanoid score I4571
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48721
OrthoDB 1 1.010 - - D1583203at2759
OrthoFinder 1 1.000 - - FOG0004699
OrthoInspector 1 1.000 - - oto91154
orthoMCL 1 0.900 - - OOG6_104457
Panther 1 1.100 - - LDO PTHR13381
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2635
SonicParanoid 1 1.000 - - X5037
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.