DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED21 and MED21

DIOPT Version :9

Sequence 1:NP_001015223.1 Gene:MED21 / 3354977 FlyBaseID:FBgn0040020 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_192387.2 Gene:MED21 / 825815 AraportID:AT4G04780 Length:139 Species:Arabidopsis thaliana


Alignment Length:137 Identity:38/137 - (27%)
Similarity:63/137 - (45%) Gaps:20/137 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRLTQLQDTVNQQAEHFCNAIGVIQQTSLPSKFVNFERIGPQTPIP----------CPPQEDYAQ 57
            |.::|||:.||..|....||.|.:|:.:.|      .::.|..|.|          .|..|...|
plant     2 DIISQLQEQVNTIAAITFNAFGTLQRDAPP------VQLSPNYPEPPATTTVTDDATPFPEQPKQ 60

  Fly    58 LFAQLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLEIENQGTARDLEEVVQKGELLLEKMQYS 122
            |.|.|: :.||..|.|:.:||..:.....|...:..|::||....::|::.::..|..|:::|  
plant    61 LSAGLV-KAAKQFDALVAALPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQ-- 122

  Fly   123 LECIAQA 129
             |...||
plant   123 -ELFGQA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED21NP_001015223.1 Med21 1..128 CDD:288119 36/134 (27%)
MED21NP_192387.2 Med21 2..130 CDD:288119 38/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004699
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104457
Panther 1 1.100 - - LDO PTHR13381
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.