DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED21 and med21

DIOPT Version :9

Sequence 1:NP_001015223.1 Gene:MED21 / 3354977 FlyBaseID:FBgn0040020 Length:142 Species:Drosophila melanogaster
Sequence 2:XP_031753607.1 Gene:med21 / 100302398 XenbaseID:XB-GENE-5719290 Length:165 Species:Xenopus tropicalis


Alignment Length:131 Identity:76/131 - (58%)
Similarity:95/131 - (72%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADRLTQLQDTVNQQAEHFCNAIGVIQQTSLPSKFVNFERIGPQTPIPCPPQEDYAQLFAQLIAR 65
            ||||||||||.:|..|:.|||||||:||.:.|:.|.|.: .|.....|..|.|:||||||.||||
 Frog     1 MADRLTQLQDALNSLADQFCNAIGVLQQCAPPASFSNIQ-TGINKDQPPNPTEEYAQLFAALIAR 64

  Fly    66 CAKDIDTLIESLPNEDSSIELQNSSLKRLEIENQGTARDLEEVVQKGELLLEKMQYSLECIAQAQ 130
            .||||:.||:|||:|:|:..||.:||.:||.||...|..|||||.:|:|||||:|.:|..|||:|
 Frog    65 TAKDIEVLIDSLPSEESTAALQAASLYQLEEENHAAAARLEEVVYRGDLLLEKIQTALADIAQSQ 129

  Fly   131 L 131
            |
 Frog   130 L 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED21NP_001015223.1 Med21 1..128 CDD:288119 72/126 (57%)
med21XP_031753607.1 Med21 1..127 CDD:402689 72/126 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5115
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3148
Inparanoid 1 1.050 137 1.000 Inparanoid score I4430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1583203at2759
OrthoFinder 1 1.000 - - FOG0004699
OrthoInspector 1 1.000 - - oto104935
Panther 1 1.100 - - LDO PTHR13381
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2635
SonicParanoid 1 1.000 - - X5037
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.