DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set1 and ASHH4

DIOPT Version :10

Sequence 1:NP_001015221.1 Gene:Set1 / 3354971 FlyBaseID:FBgn0040022 Length:1641 Species:Drosophila melanogaster
Sequence 2:NP_001319802.1 Gene:ASHH4 / 825166 AraportID:AT3G59960 Length:329 Species:Arabidopsis thaliana


Alignment Length:147 Identity:51/147 - (34%)
Similarity:79/147 - (53%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1502 KQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLR--------ETKYEAIGIGSSYL 1558
            |::|..::....:|:.|.|.|.:.|.:|||||::|...:.:.|        ||.:        ||
plant   111 KKMKLVQTEKCGYGIVADEDINSGEFIIEYVGEVIDDKICEERLWKLNHKVETNF--------YL 167

  Fly  1559 FRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLE 1623
            .:|:...:||||..||.:|:|||||:||...:...|:.|.:|.|::.:.|...|::||||:|...
plant   168 CQINWNMVIDATHKGNKSRYINHSCSPNTEMQKWIIDGETRIGIFATRFINKGEQLTYDYQFVQF 232

  Fly  1624 DEKIPCLCGAQGCRGTL 1640
            .....|.|||..||..|
plant   233 GADQDCYCGAVCCRKKL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set1NP_001015221.1 RRM_Set1 99..191 CDD:409745
U2AF_lg 255..>386 CDD:273727
N-SET 1352..1496 CDD:463344
SET_SETD1 1490..1637 CDD:380946 48/142 (34%)
ASHH4NP_001319802.1 AWS 61..110 CDD:197795
SET_ASHR3-like 112..250 CDD:380952 50/146 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.