DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set1 and CG4565

DIOPT Version :10

Sequence 1:NP_001015221.1 Gene:Set1 / 3354971 FlyBaseID:FBgn0040022 Length:1641 Species:Drosophila melanogaster
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:160 Identity:45/160 - (28%)
Similarity:78/160 - (48%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1495 NQLKFR--KKQLKFAKSAIH-DWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSS 1556
            |:|.:.  :|.|:...|.:: ..||.....|.....:.||.|:::....|..|....|.:|: .:
  Fly   102 NRLVYSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELLTVPEARSRLHDNEKLGL-MN 165

  Fly  1557 YLFRID--------METIIDATKCGNLARFINHSCNPNCYAKVITIESE-KKIVIYSKQPIGINE 1612
            |:..::        ..||:|.::.||:.|::||||.|||:...:.|:.. .||.|::.:.|...|
  Fly   166 YILVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAKE 230

  Fly  1613 EITYDYKFPLEDEKI----PCLCGAQGCRG 1638
            |:.:.|....:.:|:    .|||||..|.|
  Fly   231 ELCFHYGGEGQYKKMTGGKTCLCGASKCTG 260

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Set1NP_001015221.1 RRM_Set1 99..191 CDD:409745
U2AF_lg 255..>386 CDD:273727