DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Set1 and set-11

DIOPT Version :10

Sequence 1:NP_001015221.1 Gene:Set1 / 3354971 FlyBaseID:FBgn0040022 Length:1641 Species:Drosophila melanogaster
Sequence 2:NP_001364763.1 Gene:set-11 / 185242 WormBaseID:WBGene00018023 Length:278 Species:Caenorhabditis elegans


Alignment Length:140 Identity:47/140 - (33%)
Similarity:69/140 - (49%) Gaps:16/140 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1506 FAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLF--RIDMETI-I 1567
            ||:.....||:.|...||....:.||.|::|....|..|.        .|::||  ::..||: |
 Worm   138 FARDPWCGWGVRASVDIAFGTFIGEYAGELIDDEEAMDRH--------DSTFLFETKVGSETLTI 194

  Fly  1568 DATKCGNLARFINHSCNPNCYAKVITIESEK----KIVIYSKQPIGINEEITYDY-KFPLEDEKI 1627
            ||...||..|||||||.||.....|:.:.:|    .:..::.:.|...||:|.|| :....::|.
 Worm   195 DAKYSGNYTRFINHSCAPNVKVANISWDYDKIQLIHMCFFTDKAIRKGEELTIDYGEAWWANKKF 259

  Fly  1628 PCLCGAQGCR 1637
            ||||.:..||
 Worm   260 PCLCKSSECR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Set1NP_001015221.1 RRM_Set1 99..191 CDD:409745
U2AF_lg 255..>386 CDD:273727
N-SET 1352..1496 CDD:463344
SET_SETD1 1490..1637 CDD:380946 45/138 (33%)
set-11NP_001364763.1 PreSET 21..117 CDD:128744
SET 75..270 CDD:394802 47/140 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.