DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and LOC683422

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:245 Identity:69/245 - (28%)
Similarity:119/245 - (48%) Gaps:18/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 AGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPY 235
            |...|.||.|.:::.|  ::.|.||::::..||:|:||.:.:...:..:|.|..|..|..    .
  Rat    52 ANISEVPWHVGIMNHG--THLCGGSILNEWWVLSASHCFDQINNANLEIRHGRDDLSTKN----V 110

  Fly   236 QERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDA 300
            :...|..:||||.::...:..|.||::|..|:.|..:...||..:..|: :....|:.||||...
  Rat   111 KHEKVDKLILHPKFDDWLLDNDIALLLLKSPLNLSINGIPICTSELSDL-RIWKNCWVTGWGITN 174

  Fly   301 FGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAG-GQRGIDTCQGDGGAPLA 364
            ...:...::.:::|.:.:..::.|...|.        .|.::.:||| ...|:|.||||.|..|.
  Rat   175 VSGVKVQTTKLQKVQVDLFRWDWCGYVLP--------LLTKNMLCAGTPDGGMDACQGDSGGALV 231

  Fly   365 CPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGWIDQQMLTNG 413
            |.:.....:.| |.|||:||:||..: :|..|..|:....||.:|....|
  Rat   232 CNKKRNINTWY-QVGIVSWGVGCGKKNLPGVYTKVSPYLKWIRKQTAKAG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 67/238 (28%)
Tryp_SPc 169..405 CDD:214473 65/235 (28%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 67/238 (28%)
Tryp_SPc 46..272 CDD:214473 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.