DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:259 Identity:89/259 - (34%)
Similarity:127/259 - (49%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTG 215
            |.:...|........|....||.|.:||.|:|.......:||.||||:|..||:||||.:. ..|
Zfish    22 CQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQD-SIG 85

  Fly   216 SFTVRAGEWDTQTMKERLPYQ-ERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLP 279
            :..|:.|   .|:.....||| .::|..||.||:||..|...|.|||.|...||.:|:|..:||.
Zfish    86 TIMVKLG---LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLA 147

  Fly   280 QQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFI 344
            ...:....|...:.||||| ...:..:...:::.|.:|||..:.|:....|       .:..:.|
Zfish   148 AAGNTYAAGTLSWVTGWGK-LSSAANQIPDILQEVEIPIVSHSDCKRAYPG-------EITSNMI 204

  Fly   345 CAG--GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGWI 405
            |||  .|.|.|:||||.|.|:....|    |::.|:|||::|.||.:. .|..||.|:..:.||
Zfish   205 CAGLLDQGGKDSCQGDSGGPMVSRNG----SQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 87/244 (36%)
Tryp_SPc 169..405 CDD:214473 84/239 (35%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 85/244 (35%)
Tryp_SPc 36..264 CDD:238113 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.