DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and zgc:123217

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:286 Identity:89/286 - (31%)
Similarity:136/286 - (47%) Gaps:42/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGV-----RNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVE 210
            |||     |..||.|          |..|.:||.|: :|..| .:.|.|:|||.|.|:|||||:.
Zfish    28 CGVAPLNTRIVGGTD----------APAGSWPWQVS-IHYNN-RHICGGTLIHSQWVMTAAHCII 80

  Fly   211 SLRTGSFTVRAGEWDTQTMKERLPYQER-SVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHIN 274
            :.....:|:..|. .||:.....|.:.: .:|::|.||.:|...:..|.:|:.|||||....:|.
Zfish    81 NTNINVWTLYLGR-QTQSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIR 144

  Fly   275 VICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSL-----MKRVPLPIVEFNSCQTRLRGTRLG 334
            .|||...:.|...|.:|::|||     |::||..:|     :::|.:|:|..:.|.|......  
Zfish   145 PICLAANNSIFYNGTSCWATGW-----GNIGKDQALPAPQTLQQVQIPVVANSLCSTEYESVN-- 202

  Fly   335 PKFALDRSFICAG-GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWG--IGCN-DEVPAAY 395
             ...:....|||| ..:|  |||||.|.|..|.:||.    :.|.||.::|  .||. ...|..|
Zfish   203 -NATITPQMICAGKANKG--TCQGDSGGPFQCKQGSV----WIQAGITSYGTSAGCAVGAYPDVY 260

  Fly   396 ANVALVRGWIDQQMLTNGFGTAVYTA 421
            :.|:..:.||...:..:......:|:
Zfish   261 SRVSEFQSWIKMNVQGSAIDFVTFTS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 81/251 (32%)
Tryp_SPc 169..405 CDD:214473 79/245 (32%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 83/260 (32%)
Tryp_SPc 37..273 CDD:238113 84/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.