DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG18735

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:278 Identity:90/278 - (32%)
Similarity:127/278 - (45%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LNKTLNP-TPLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGS 195
            :...|.| .|.:......|.|...:.|.::.....|...|....|:||.:.|:..||  ::|..|
  Fly    49 IQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGN--FYCGAS 111

  Fly   196 LIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFAL 260
            |::.|..|||||||........|||..|.:.|....::  .:|.|..|::||.|:.|:...|.||
  Fly   112 LVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKI--VDRRVSRVLIHPKYSTRNFDSDIAL 174

  Fly   261 VILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQ 325
            :..::||.|...::.:|:|...: ...|.|...||||  |....|..|..::.|.:||:....| 
  Fly   175 IRFNEPVRLGIDMHPVCMPTPSE-NYAGQTAVVTGWG--ALSEGGPISDTLQEVEVPILSQEEC- 235

  Fly   326 TRLRGTRLGPKFALDRSFICAG--GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC- 387
               |.:..|.....| :.||||  .|.|.|:||||.|.|:.. .||  ...||..|||:||.|| 
  Fly   236 ---RNSNYGESKITD-NMICAGYVEQGGKDSCQGDSGGPMHV-LGS--GDAYQLAGIVSWGEGCA 293

  Fly   388 NDEVPAAYANVALVRGWI 405
            ....|..|..|.....||
  Fly   294 KPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 84/243 (35%)
Tryp_SPc 169..405 CDD:214473 81/238 (34%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/243 (34%)
Tryp_SPc 83..314 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.