DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG34458

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:103/253 - (40%) Gaps:59/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQER 238
            |:||..|:|..:|.  :.|.||||...:::|||||......|......|..|......    |..
  Fly    41 GQFPHQVSLQLNGR--HHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGNG----QTF 99

  Fly   239 SVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGS 303
            ::...|:||.||.:|..:|.:|:.||.||.:...:..|.|...|           :.:..|....
  Fly   100 NIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSD-----------SNYAADTMAM 153

  Fly   304 LGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFA-----------------LDRSFICAGGQRG 351
            :..:.::.:.:.||             .||  |||                 |....:|||...|
  Fly   154 ISGFGAINQNLQLP-------------NRL--KFAQVQLWSRDYCNSQNIPGLTDRMVCAGHPSG 203

  Fly   352 -IDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGWIDQ 407
             :.:||||.|.||      |.:.:.  .|:|:||.||..: .||.|..|..:|.||.|
  Fly   204 QVSSCQGDSGGPL------TVDGKL--FGVVSWGFGCGAKGRPAMYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 70/253 (28%)
Tryp_SPc 169..405 CDD:214473 67/249 (27%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 67/249 (27%)
Tryp_SPc 32..254 CDD:238113 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.