DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and cela1.3

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:256 Identity:79/256 - (30%)
Similarity:125/256 - (48%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 DFTLSG--VSQNEAGFGEFPWTVALLHSGNLSYF--CAGSLIHKQVVLTAAHCVESLRTGSFTVR 220
            |..:.|  |....|....:||.::|.:....||:  |.||||....|:||||||:|.||  :.|.
Zfish    38 DIDIEGRVVGGEVAKPNSWPWQISLQYLSGSSYYHTCGGSLIRPGWVMTAAHCVDSPRT--WRVV 100

  Fly   221 AGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIA--YDFALVILSQPVTLDDHINVICLPQQDD 283
            .|:.|....:.|..|  .||....:||::|..|::  ||.||:.||...:|:.::.:..||....
Zfish   101 LGDHDIYNHEGREQY--ISVSRAHIHPNWNSNSLSSGYDIALLELSSDASLNSYVQLAALPPSGQ 163

  Fly   284 IPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGG 348
            :....|.|:.:|||:...|  |..|:.:|:..||:|:.::|.   |....|.  .:..:.|| ||
Zfish   164 VLPNNNPCYISGWGRTQTG--GSLSAELKQAYLPVVDHDTCS---RSDWWGS--TVKNTMIC-GG 220

  Fly   349 QRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAW--GIGCN-DEVPAAYANVALVRGWID 406
            ...:..|.||.|.||.|    ....:|...|:.::  ..||| ::.|..::.|:....||:
Zfish   221 DGTLAGCHGDSGGPLNC----QVSGQYVVHGVTSFVSSAGCNTNKRPTVFSRVSAYISWIN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 77/248 (31%)
Tryp_SPc 169..405 CDD:214473 74/242 (31%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133791
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.