DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG11313

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:441 Identity:116/441 - (26%)
Similarity:171/441 - (38%) Gaps:133/441 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NGYTNNCISI--CAILLIGVSSPAPQQNINAQKNIEEIFNTNSNLSAQKESGIGLVITPDPMETI 64
            |..|..|::|  |          .|..::.|:.|     .|:|.:...:||..          .:
  Fly    28 NQRTGYCVNIPLC----------VPLNSVLAKSN-----PTDSEMRFIRESRC----------LV 67

  Fly    65 SQQSNFTSTSGKTATCNCVPYYKCDPSTKSFTEDGSFDGFGVIDIRFNDDDPICPASVDVCCDAN 129
            |.||:             :|:..|.|.|          .:.....|.||:               
  Fly    68 SDQSD-------------LPFVCCTPDT----------DYNTTRARPNDE--------------- 94

  Fly   130 RTLNKTLNPTPLDQRPNQPRGCGVRNTGGLDFTLSGVSQ-NEAGFGEFPWTVAL---LHSG-NLS 189
             .::.||.|.              |:..|.|...:.::: ||....||.|.|.|   .|.| .|.
  Fly    95 -VIHSTLLPD--------------RSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLR 144

  Fly   190 YFCAGSLIHKQVVLTAAHCVES---LRTG--SF--TVRAGEWDTQTMKERL-------PYQERSV 240
            .:||||||:.:.|:||||||.:   .|.|  ||  :||.||.:|..:.:.|       |.| .:|
  Fly   145 TYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQ-IAV 208

  Fly   241 QTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIP--QPGNTCFSTGWGKDAFGS 303
            :.:.:|..:..|....|.||:.|::.|.....|..:|||....:.  |.|......|||:    :
  Fly   209 EEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGR----T 269

  Fly   304 LGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGP-----KFA----LDRSFICAGGQRGIDTCQGDG 359
            |...||.:|             .:||.|.:.|     |:|    |..|.:||.|:...|:|.||.
  Fly   270 LTSESSPVK-------------MKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDS 321

  Fly   360 GAPLACPRGSTRESRYQQTGIVAWGIGCNDEV-PAAYANVALVRGWIDQQM 409
            |.||.    :..|..:...|||::|:.|.... ||.|.||.....||.|.:
  Fly   322 GGPLM----AFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 87/272 (32%)
Tryp_SPc 169..405 CDD:214473 85/265 (32%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 16/87 (18%)
Tryp_SPc 116..367 CDD:238113 87/272 (32%)
Tryp_SPc 116..364 CDD:214473 85/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.