DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG9737

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:406 Identity:108/406 - (26%)
Similarity:166/406 - (40%) Gaps:79/406 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ESGIGLVITPDPMETISQQSNFTSTSGKTATCNCVPYYKCDPSTKSFTEDGSFDGFGVIDIRFND 113
            |:..|:.:.....:...|..|.|:...:..  |.:...:|:...:.....||::..         
  Fly    33 ETKRGVCLEVSRCKAYLQVRNATNLPAEKV--NFLKKVQCEVEQQVSEAQGSYESL--------- 86

  Fly   114 DDPICPASVDVCCDANR-------------TLNKTLNPTPLDQRPNQPR---------GCGVRNT 156
                      |||.||.             ...:.|:.|...:|....|         |..:.|.
  Fly    87 ----------VCCPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNE 141

  Fly   157 GGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESL----RTGSF 217
            .|...|........|...||||...|:::.| .|.|:|:||..:.:|||||||:..    |.|..
  Fly   142 CGKQVTNRIYGGEIAELDEFPWLALLVYNSN-DYGCSGALIDDRHILTAAHCVQGEGVRDRQGLK 205

  Fly   218 TVRAGEWDTQTMKERLPYQ----------ERSVQTVILHPDYNRRS-IAY-DFALVILSQPVTLD 270
            .||.||::.:|..:.:...          :.:.:.:.:||:|...| ..| |.|::.|..||:..
  Fly   206 HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT 270

  Fly   271 DHINVICLPQQDD-IPQPGNTCFS-TGWGK-DAFGS--LGKYSSLMKRVPLPIVEFNSCQTRLR- 329
            ..:..||||.:.: :.......|| :|||: |.|..  :..:|.:..::.:|.|...:|...|. 
  Fly   271 HFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEG 335

  Fly   330 -GTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGI---GCNDE 390
             |.|||||      .|||||:...|||.||.|.||.  ....:.||:...|:|::|.   |...:
  Fly   336 FGVRLGPK------QICAGGEFAKDTCAGDSGGPLM--YFDRQHSRWVAYGVVSYGFTQCGMAGK 392

  Fly   391 VPAAYANVALVRGWID 406
             ||.|.|||....|||
  Fly   393 -PAVYTNVAEYTDWID 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 86/267 (32%)
Tryp_SPc 169..405 CDD:214473 83/261 (32%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 10/76 (13%)
Tryp_SPc 149..406 CDD:214473 83/266 (31%)
Tryp_SPc 150..409 CDD:238113 86/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.