DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG31266

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:270 Identity:72/270 - (26%)
Similarity:112/270 - (41%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESL 212
            |:|   |..||          ..|..|.:|| :|.:.:....:.|...::.:..|||||.||..|
  Fly    48 PQG---RVIGG----------TTAAEGNWPW-IASIQNAYSYHLCGAIILDETWVLTAASCVAGL 98

  Fly   213 RTGSFTVRAGE---WDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHIN 274
            |..:..|..|.   ||...     ||.  :|..:.:|.::::.....|.||:.||..:..:|...
  Fly    99 RPLNLLVVTGTVDWWDLYA-----PYY--TVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTK 156

  Fly   275 VICLPQQDDIPQPGNTCFSTGWG-KDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFA 338
            .|.|...|::.:.....|: ||| .:|.|:.|:|........||:   ::|:.:|:.     :..
  Fly   157 NITLADIDELEEGDKLTFA-GWGSSEAMGTYGRYLQEASGTYLPV---DACREKLQN-----QDD 212

  Fly   339 LDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDEVPAAYANVALVRG 403
            :|...:|.....|...|.||.|.||.       :.:.:..||..||:.|....|..||..|....
  Fly   213 VDLGHVCVQMDAGQGACHGDTGGPLI-------DEQQRLVGIGNWGVPCGRGYPDVYARTAFYHD 270

  Fly   404 WIDQQMLTNG 413
            ||...|  ||
  Fly   271 WIRTTM--NG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 64/245 (26%)
Tryp_SPc 169..405 CDD:214473 62/239 (26%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/254 (26%)
Tryp_SPc 52..275 CDD:238113 66/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.