DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG14892

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:398 Identity:86/398 - (21%)
Similarity:137/398 - (34%) Gaps:161/398 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGVRNTGGLDFTLSGVSQNEAGFGEFPW--TVALLHS--GNLSYFCAGSLIHKQVVLTAAHCVES 211
            ||.|........::|.:.||   |:|||  ::.|||.  |.|.::|...|||:..:|:|||||.:
  Fly    70 CGCRPARRGPRIIAGAATNE---GQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHN 131

  Fly   212 ---------LRTGSFTVRAGEWDTQT---MKERLPYQERSVQTVILHPDYNRRSIAYDFALVILS 264
                     |    :||..||.|...   .::|:|     |:.:::|..|:  :..:|..|:.||
  Fly   132 DLFNLPIPPL----WTVVLGEHDRDVESGNEQRIP-----VEKIVMHHRYH--NFKHDVVLMKLS 185

  Fly   265 QPVTLDDHINV--ICLP---------------------------QQ---DDIPQPGNT------- 290
            :|..|....|:  ||||                           ||   :|:|:..:.       
  Fly   186 KPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQS 250

  Fly   291 ----------------------------------------------------------------- 290
                                                                             
  Fly   251 RRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPK 315

  Fly   291 ------------CFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSF 343
                        |.:|||||....  |..|:.:.:..:|:.:...|:     ...|....:....
  Fly   316 VSDEPKEIAFVDCVATGWGKANIS--GDLSNQLLKTQVPLHQNGRCR-----DAYGSFVNIHGGH 373

  Fly   344 ICAG---GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGW 404
            :|||   |:.|  ||.||.|.||.|  ..:|:..:...|:.::|.||..| .|..|...:....|
  Fly   374 LCAGKLNGEGG--TCVGDSGGPLQC--RLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKW 434

  Fly   405 IDQQMLTN 412
            |:..:.|:
  Fly   435 IEDTIATH 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 81/377 (21%)
Tryp_SPc 169..405 CDD:214473 79/371 (21%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 80/379 (21%)
Tryp_SPc 81..438 CDD:238113 82/381 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.