DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and ea

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:324 Identity:97/324 - (29%)
Similarity:137/324 - (42%) Gaps:66/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VCC-DANRTLNKTLNPTPLDQRPN--------QPRGCG----VRNTGGLDFTLSGVSQNEAGFGE 175
            :|| |..|..:....|.|   :||        .|..||    .|..||:          :....|
  Fly    87 ICCPDRYRESSSETTPPP---KPNVTSNSLLPLPGQCGNILSNRIYGGM----------KTKIDE 138

  Fly   176 FPWTVALLH----SGNLSYFCAGSLIHKQVVLTAAHCV--ESLRT-----GSFTVRAGEWDTQT- 228
            ||| :||:.    .|...:.|.||||..:.|:||:|||  ::|.|     |   ||.|||||.| 
  Fly   139 FPW-MALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSG---VRLGEWDTNTN 199

  Fly   229 ---------MKE-RLPYQERSVQTVILHPDY--NRRSIAYDFALVILSQPVTLDDHINVICLPQQ 281
                     ||: ..|:.:..|:..|.||||  ..::...|.||:.|:|.|...|.:..||||..
  Fly   200 PDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLD 264

  Fly   282 DDIPQ---PGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSF 343
            .::..   .|.|....||||....|.   |:|..:..:.....:.||    .........|:.:.
  Fly   265 VNLRSATFDGITMDVAGWGKTEQLSA---SNLKLKAAVEGFRMDECQ----NVYSSQDILLEDTQ 322

  Fly   344 ICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWG-IGCN-DEVPAAYANVALVRGWI 405
            :||||:.|:|:|:||.|.||.....:...:.|...|:|::| ..|. ...|..|..|.....||
  Fly   323 MCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 83/269 (31%)
Tryp_SPc 169..405 CDD:214473 81/264 (31%)
eaNP_524362.2 CLIP 37..89 CDD:288855 0/1 (0%)
Tryp_SPc 127..386 CDD:214473 84/279 (30%)
Tryp_SPc 128..389 CDD:238113 85/280 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.