DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG3916

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:241 Identity:67/241 - (27%)
Similarity:100/241 - (41%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PWTVAL--LHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAG--EWDTQTMKERLPYQE 237
            |:.|:|  ...|...:||.||::..|.|||||||:|.::....:|..|  .|....::.||    
  Fly    42 PFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRL---- 102

  Fly   238 RSVQTVILHPDYNRR-SIAYDFALVILSQPVTLD-DHINVICLPQQDDIPQ--PGNTCFSTGWGK 298
               .|..:||.|:.. .|..|.|||.::.|..|: ..|:.|.:...|.|.:  |...   ||||.
  Fly   103 ---VTKHVHPQYSMNPRIINDIALVKVTPPFRLERSDISTILIGGSDRIGEKVPVRL---TGWGS 161

  Fly   299 DA-FGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAP 362
            .: ..|.......::.:....:....|..:        .|.:.|:.|||...:|...|.||.|.|
  Fly   162 TSPSTSSATLPDQLQALNYRTISNEDCNQK--------GFRVTRNEICALAVQGQGACVGDSGGP 218

  Fly   363 LACPRGSTRESRYQQTGIVAWGIG-CNDEVPAAYANVALVRGWIDQ 407
            |..|     ..:....|||::|.. |....|..|..|:....:|.|
  Fly   219 LIRP-----GKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYISQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 67/241 (28%)
Tryp_SPc 169..405 CDD:214473 65/237 (27%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 65/237 (27%)
Tryp_SPc 31..260 CDD:238113 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.