DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG17404

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:286 Identity:81/286 - (28%)
Similarity:123/286 - (43%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 GVRNTGGLDFTLSGVSQNEAGF-------------GE-FPWTVALLH--SGNLSYFCAGSLIHKQ 200
            ||...||:...|:  |:..:|:             || .|:.|:|.:  .|...:||.||:|...
  Fly    11 GVVALGGVFGRLN--SRQPSGYTPHRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPN 73

  Fly   201 VVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQERS-VQTVILHPDYNRRSIAYDFALVILS 264
            .:||||||.:.|.....:|.||   .:.:.|:   ..|| |.:..:||.| :..:..|.|::.:.
  Fly    74 RILTAAHCCQGLNASRMSVVAG---IRGLNEK---GSRSQVLSYSIHPKY-QELVTSDLAVLSIK 131

  Fly   265 QPVTLDDH-INVI-CLPQQDDIPQPGNTCFSTGWG-----KDAFGSLGKYSSLMKRVPLPIVEFN 322
            .|:.|::. |:.| ...|..|....|.....||||     ...|.....|.::::|:....:..:
  Fly   132 PPLKLNNSTISAIEYRSQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNS 196

  Fly   323 SCQTRLRGTRLGPKFALDRSFICAGGQ-RGIDTCQGDGGAPLACPRGSTRESR--YQQTGIVAWG 384
            .|:      ..|.:...|.. |||.|. ||  .|.||.|.||      ..||:  .||.|||::|
  Fly   197 ECR------NAGMESVTDTE-ICARGPFRG--ACSGDSGGPL------VMESKNGLQQVGIVSYG 246

  Fly   385 -IGCNDEV-PAAYANVALVRGWIDQQ 408
             :.|...: |..|..|:....||..|
  Fly   247 LVVCGLYISPDVYTRVSTFSDWIGNQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 75/270 (28%)
Tryp_SPc 169..405 CDD:214473 72/264 (27%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 71/256 (28%)
Tryp_SPc 35..269 CDD:238113 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.