DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG13318

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:430 Identity:137/430 - (31%)
Similarity:196/430 - (45%) Gaps:68/430 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISICAILLIGVSSPAP-----QQNINAQKNIEEIFNTNSNLSAQKESGIGLVITPD-------PM 61
            ::|.:.|.:|..|..|     .|:.|......::.:|.::....::..:|.::.|.       |:
  Fly    16 LNIGSGLGVGAWSFGPVQSDASQDTNRVPQPSDVGSTANHTILARQLIVGTLLPPQVAPGTWPPV 80

  Fly    62 ETISQQSNFTSTSGKTATCNCVPYYKCDPSTKSFTEDGSFDGFGVIDIRF--NDDDPICPAS--- 121
            .:|        .|..|:.|.|||...|.....:...|||    |.||||.  |...|..|.:   
  Fly    81 PSI--------VSPGTSYCQCVPPGSCANPLPTAPSDGS----GQIDIRIVNNGGYPTVPTTSST 133

  Fly   122 ------VDVCCDANRTLNKTLNPTPLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTV 180
                  :..||.|.........|.|.......|                    .:|.||.:||..
  Fly   134 LTCSYGLVACCQAGSYQCGRRFPPPPGSTTAAP--------------------GQASFGAYPWQA 178

  Fly   181 ALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVIL 245
            |||.:.:: |...|:||..|.||||||.|.:|....|.||.||||..:..|.:|.|:..:..|.:
  Fly   179 ALLTTADV-YLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYV 242

  Fly   246 HPDYNRRSIAYDFALVILSQPVTLDDH--INVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYS 308
            :|.:|..::..|.|::.||.||:|...  :..:|||....:   |..|:..||||:.||:.|.|.
  Fly   243 NPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTSFV---GQRCWVAGWGKNDFGATGAYQ 304

  Fly   309 SLMKRVPLPIVEFNSCQTRLRGTRLGPKFALD-RSFICAGGQRGIDTCQGDGGAPLACPRGSTRE 372
            ::.::|.:|::...:||..|:.||||..|.|. .|||||||:.|.|.|.||||:||.|    |..
  Fly   305 AIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVC----TSN 365

  Fly   373 SRYQQTGIVAWGIGCNDE-VPAAYANVALVRGWIDQQMLT 411
            ..:...|:|||||||... ||..|.||.....|| |..||
  Fly   366 GVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWI-QTTLT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 98/245 (40%)
Tryp_SPc 169..405 CDD:214473 96/239 (40%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 99/241 (41%)
Tryp_SPc 169..399 CDD:214473 96/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.