DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Prss46

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_006244055.1 Gene:Prss46 / 408245 RGDID:1302970 Length:314 Species:Rattus norvegicus


Alignment Length:262 Identity:79/262 - (30%)
Similarity:126/262 - (48%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVE-SLRT 214
            ||..|     .:...|:......|::||.|::|..|  .|.|:|||||...|||||||:: |...
  Rat    35 CGQTN-----ISCKVVNGKVVEVGKWPWQVSILFLG--MYICSGSLIHHHWVLTAAHCLQRSKNP 92

  Fly   215 GSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLP 279
            .::||:.|   .||:.:. ...|..|.::::|.::... :::|.|::.|..|||....|..||||
  Rat    93 ANYTVKVG---VQTLPDN-SSSELLVTSIVIHENFINH-MSHDIAILKLKYPVTWSPFIQPICLP 152

  Fly   280 QQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRL-GPKFALDRSF 343
            :.:..|..|..|:..|||.:......|....::.|.:.||....|..|.:...| ..|..:....
  Rat   153 EVNFKPSIGTMCWVIGWGLEKAKGAPKTPYSVQGVAVRIVNNEICNHRYQFLLLKNQKKFIGNDM 217

  Fly   344 ICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC-NDEVPAAYANVALVRGWIDQ 407
            :|...:.|:||||...|:.|.|....|    :.|.|:|:|..|| ..:.|:.|.:.:....||.:
  Rat   218 LCTSPEWGLDTCQDASGSSLVCQMNKT----WIQMGVVSWNFGCGRRQFPSIYTSTSHFTQWIKR 278

  Fly   408 QM 409
            |:
  Rat   279 QI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 75/244 (31%)
Tryp_SPc 169..405 CDD:214473 72/238 (30%)
Prss46XP_006244055.1 Tryp_SPc 43..276 CDD:214473 73/243 (30%)
Tryp_SPc 44..279 CDD:238113 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.