DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG4477

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:235 Identity:63/235 - (26%)
Similarity:103/235 - (43%) Gaps:34/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 SYFCAGSLIHKQVVLTAAHCVESLRTGSFTVR-----AGEWDTQTMKERLPY-QERSVQTVILH- 246
            ::||:|.::....|:|:|||:.:.|....:.|     ||..:      ||.| ..|:..|.:.| 
  Fly    69 NHFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLN------RLKYIPNRTFVTPVTHI 127

  Fly   247 --PDYNRRSIAYDFALVILSQPVTL-DDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYS 308
              ||........||.|:.:..|... ::||::..||...  |.||..|...|||:...|  |..:
  Fly   128 WLPDSFTMRNKQDFGLLKVKNPFPRNNEHISIARLPVHP--PLPGLKCKVMGWGRMYKG--GPLA 188

  Fly   309 SLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRES 373
            |.|..:.:.:::..:|...||...:....|:|...:.|.     ..|.||.|||: ...|:.   
  Fly   189 SYMLYIDVQVIDSEACAKWLRVPSVEHVCAVDSDDLTAQ-----QPCGGDWGAPM-LHNGTV--- 244

  Fly   374 RYQQTGIVAWGIGCN-DEVPAAYANVALVRGWIDQQMLTN 412
                .|||....||. ..:|:.|.||.....||.::::::
  Fly   245 ----YGIVTILAGCGVSHLPSLYTNVHSNANWIHEKIISS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 63/229 (28%)
Tryp_SPc 169..405 CDD:214473 61/226 (27%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 63/229 (28%)
Tryp_SPc 55..273 CDD:214473 61/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.