DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG14990

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:278 Identity:121/278 - (43%)
Similarity:153/278 - (55%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTA 205
            |...|||.  ||:.|..||...:. |.::.:..|:|||.|||...|  .||.|||||..:|||||
  Fly    40 LQPDPNQV--CGMSNPNGLVANVK-VPKDYSTPGQFPWVVALFSQG--KYFGAGSLIAPEVVLTA 99

  Fly   206 AHCVESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLD 270
            |..|.........||||||:|....|.||.::|.|..|:.|.:::....|.:.||:.|:.|..|.
  Fly   100 ASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELK 164

  Fly   271 DHINVICLPQQDDIPQPGNT-----CFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRG 330
            .||..||||.|      |.:     |..|||||.||.. ..||::.|::.||::....||.:||.
  Fly   165 SHIRTICLPSQ------GRSFDQKRCLVTGWGKVAFND-ENYSNIQKKIELPMINRAQCQDQLRN 222

  Fly   331 TRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAA 394
            ||||..|.|..|.|||||::....|.||||:.|.||. ....|||:|.|||.|||||.:| |||.
  Fly   223 TRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPM-EADPSRYEQAGIVNWGIGCQEENVPAV 286

  Fly   395 YANVALVRGWIDQQMLTN 412
            |.||.:.|.||.:.|..|
  Fly   287 YTNVEMFRDWIYEHMAQN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 110/247 (45%)
Tryp_SPc 169..405 CDD:214473 107/241 (44%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 109/242 (45%)
Tryp_SPc 67..297 CDD:214473 107/239 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.