DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG9294

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:124/273 - (45%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGVRNT-----GGLDFTLSGVSQNEAGFGEFPW-TVALLHSGNLSYFCAGSLIHKQVVLTAAHCV 209
            ||:.||     ||          .|....::|| .|.|:::   .::|:||||:...||||||||
  Fly    92 CGLINTLYKIVGG----------QETRVHQYPWMAVILIYN---RFYCSGSLINDLYVLTAAHCV 143

  Fly   210 ESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDH-I 273
            |.:.....|:|..|.:.....:.:..| |.|..|.:|..||.||...|.|::.|:||:.:..| :
  Fly   144 EGVPPELITLRFLEHNRSHSNDDIVIQ-RYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRL 207

  Fly   274 NVICLPQQDDIPQPGNTCFS--------TGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRG 330
            ..||||.|.         :|        .|||....|..|  :..::.|.:.::..:.|:   .|
  Fly   208 RPICLPVQS---------YSFDHELGIVAGWGAQREGGFG--TDTLREVDVVVLPQSECR---NG 258

  Fly   331 TRLGPKFALDRSFICAG--GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC-NDEVP 392
            |...|....| :.:|||  .:.|.|.|.||.|.||. .....:..:||..|||:||:|| ..:.|
  Fly   259 TTYRPGQITD-NMMCAGYISEGGKDACSGDSGGPLQ-TTFDEQPGQYQLAGIVSWGVGCARPQSP 321

  Fly   393 AAYANVALVRGWI 405
            ..|..|.....|:
  Fly   322 GVYTRVNQYLRWL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 78/253 (31%)
Tryp_SPc 169..405 CDD:214473 77/248 (31%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 79/262 (30%)
Tryp_SPc 101..334 CDD:238113 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.