DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG8172

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:457 Identity:131/457 - (28%)
Similarity:188/457 - (41%) Gaps:89/457 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SP--APQQNINAQKNIEEIF---NTNSNL---SAQKESGIGLVITPDPMETISQQ------SNFT 71
            ||  ||..|.:...::.:|:   :||:|.   .....||.||...|....|.|..      |::.
  Fly   121 SPHAAPVNNTSDIIHLHDIYPDLSTNANKPQHHLHHHSGNGLSAAPSTSSTASSSARPAYPSSYY 185

  Fly    72 STSGKTATCNCVPYY-------KCDPSTKSFTEDGSFD-----GFGVIDIRFNDDDPICPASVDV 124
            .|...|......||.       ...||:.|.:...|::     ..|.|....|..|....|    
  Fly   186 GTKRPTHYSGSNPYKPGSSAGGSSRPSSSSSSSLNSWEHETGGHLGSISGITNHLDSFFDA---- 246

  Fly   125 CCDANRTLNKTLNPTPLDQRPN---------------------QPRGCG---------VRNTGGL 159
              ::...|:....|.|.:..||                     |..|.|         |...|.:
  Fly   247 --ESQAPLDSAGAPPPHEPLPNAQAFAVGNVLDLNAGEAADEYQSGGSGGYHDASYRPVPGCGEV 309

  Fly   160 DFTLSG--VSQNEAGFGEFPWTVALLHSGNLS--YFCAGSLIHKQVVLTAAHCVESLRTGSFTVR 220
             :|.|.  |..:..|||..||.|||:.||.|:  ..|.|:||..:.|:||||||.|....:..:|
  Fly   310 -YTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIR 373

  Fly   221 AGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIP 285
            .||||.:..:|||.::|..::...:||.||......|.||:.|.:.|....||..:|||      
  Fly   374 LGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLP------ 432

  Fly   286 QPGNTCFS------TGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFI 344
             |..|..:      .|||:...|. ....|:::.|.:.::..:.||...|..  |.:.|:...|:
  Fly   433 -PSTTKLTGKMATVAGWGRTRHGQ-STVPSVLQEVDVEVISNDRCQRWFRAA--GRREAIHDVFL 493

  Fly   345 CAG-GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGWIDQ 407
            ||| ...|.|:||||.|.||..    |.:.|....|:|:|||||..| :|..|.|:.....||::
  Fly   494 CAGYKDGGRDSCQGDSGGPLTL----TMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINK 554

  Fly   408 QM 409
            .|
  Fly   555 VM 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 88/251 (35%)
Tryp_SPc 169..405 CDD:214473 85/245 (35%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 86/250 (34%)
Tryp_SPc 316..555 CDD:238113 88/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.