DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG18478

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:271 Identity:103/271 - (38%)
Similarity:147/271 - (54%) Gaps:12/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTG 215
            ||..|...:....: |::.:|...|||||:|::|  |.|....||||...:||||||.:.:....
  Fly    31 CGYGNPDAVKVQFN-VTEGQAKPAEFPWTIAVIH--NRSLVGGGSLITPDIVLTAAHRIFNKDVE 92

  Fly   216 SFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQ 280
            ...|.||||:..:..|:.|::|..|..:::|..:|.:..|.:.||:.|.:...|...||.||||.
  Fly    93 DIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPT 157

  Fly   281 QDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFIC 345
            |.. ......|...||||..|... .|..::|::.||||..:.||.:||.||||..:.|.|..||
  Fly   158 QKR-SLSSTRCIVAGWGKYQFSDT-HYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLIC 220

  Fly   346 AGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGWIDQQM 409
            |||::..|.|.||||..|.||. :....:::|.|||.||:||.:: |||.|.:|...:.||.||:
  Fly   221 AGGEKDNDACTGDGGGALFCPM-TEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQI 284

  Fly   410 LTNGFGTAVYT 420
            ..|     :||
  Fly   285 KEN-----LYT 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 95/242 (39%)
Tryp_SPc 169..405 CDD:214473 92/236 (39%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 94/237 (40%)
Tryp_SPc 50..280 CDD:214473 92/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.