DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and prss60.3

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:282 Identity:88/282 - (31%)
Similarity:128/282 - (45%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CG-----VRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNL-SYFCAGSLIHKQVVLTAAHCV 209
            ||     .|..||::          |..|.:||.|: |||... .:||.||||..:.|||||||:
Zfish    27 CGQAPLNTRIVGGVN----------ASPGSWPWQVS-LHSPKYGGHFCGGSLISSEWVLTAAHCL 80

  Fly   210 ESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHIN 274
            ..:...:..|..|....|.:  .:....|:|....:|..||..:...|.||:.||..||..::|.
Zfish    81 SGVSETTLVVYLGRRTQQGI--NIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIR 143

  Fly   275 VICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRL-RGTRLGPKFA 338
            .:||..|:.:...|.:.:.||||....|.......:::...:|:|..:.|...| .||       
Zfish   144 PVCLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGT------- 201

  Fly   339 LDRSFICAG-GQRGIDTCQGDGGAPLA---CPRGSTRESRYQQTGIVAWGIGCND-EVPAAYANV 398
            :..:.|||| .|.|.||||||.|.|:.   |       :.:.|.||.:||.||.| ..|..|..|
Zfish   202 VTNNMICAGLTQGGKDTCQGDSGGPMVTRLC-------TVWVQAGITSWGYGCADPNSPGVYTRV 259

  Fly   399 ALVRGWIDQQMLTNGFGTAVYT 420
            :..:.||..::..|..|..::|
Zfish   260 SQYQSWISSKISLNKPGFILFT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 80/248 (32%)
Tryp_SPc 169..405 CDD:214473 78/242 (32%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 82/259 (32%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.