DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG18557

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:338 Identity:110/338 - (32%)
Similarity:169/338 - (50%) Gaps:39/338 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ATC----NCVPYYKCDPSTKSFTEDGSFDGFGVIDIRFNDDDPICPASVDVCCDANRTLNKTLNP 138
            |.|    .|||...|  .|.::.::.           .:...| |..| :.||.:::   |.:..
  Fly    20 APCGLQMECVPQGLC--KTSAWNQNA-----------ISWPSP-CQRS-ESCCHSSQ---KLVIG 66

  Fly   139 TPLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVL 203
            .||:        ||..|..||..|:..| .::|...||||||||:.: .:::|.||:|:.:.:|:
  Fly    67 APLN--------CGKSNPNGLGGTVEEV-VDQAKPNEFPWTVALMQN-LINFFGAGTLVTENIVI 121

  Fly   204 TAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVT 268
            ||||.:.......|.:..|.||.:.:..: ..|.|:...::.|||:|:.:.|.:.||::|.....
  Fly   122 TAAHLMLDKTINDFGIIGGAWDLKQLAGK-TIQWRTATRIVSHPDFNKMTGANNIALIVLETSFV 185

  Fly   269 LDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGK-YSSLMKRVPLPIVEFNSCQTRLRGTR 332
            :...|..||.| ...:......|...|||:..|  |.| ||...|::.||||..:.|::.||.|.
  Fly   186 MKPPIGPICWP-TSGVSFDRERCLVAGWGRPDF--LAKNYSYKQKKIDLPIVSRSDCESLLRRTA 247

  Fly   333 LGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCN-DEVPAAYA 396
            ....|.||.:.:||||:||.|.|.||||:||.||... ..:.|:..|||..|..|. :.|||.|.
  Fly   248 FVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPG-HPAIYELVGIVNSGFSCGLENVPALYT 311

  Fly   397 NVALVRGWIDQQM 409
            |::.:|.||::|:
  Fly   312 NISHMRPWIEKQL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 88/243 (36%)
Tryp_SPc 169..405 CDD:214473 85/237 (36%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 87/240 (36%)
Tryp_SPc 90..320 CDD:214473 85/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.