DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG4259

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:241 Identity:84/241 - (34%)
Similarity:118/241 - (48%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 FPWTVALLHSGN--LSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQER 238
            |||.|::|...:  ..|...||||:..|||||||.:.........||||||||.|..:: .:.:.
  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQ-QHVDL 102

  Fly   239 SVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGS 303
            .|..::.|..:||.:...:.||:||.....:..:||:|.|..|:...|.| :||..||||....|
  Fly   103 EVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKG-SCFFNGWGKVYLNS 166

  Fly   304 LGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRG 368
            . .|.:::|.|.:.::....|.:|        |..:.:  ||..|..||| |.|||||||.| |.
  Fly   167 T-DYPTVLKTVQVDLLSMGMCSSR--------KLPIQQ--ICGKGLEGID-CSGDGGAPLVC-RI 218

  Fly   369 STRESRYQQTGIVAWGIGCNDEVPA-----AYANVALVRGWIDQQM 409
            .|...:|.|.|||.|    ..:.|.     .:.|||.:..|||..:
  Fly   219 LTYPYKYAQVGIVNW----LSQKPVENTFIVFTNVAGLLPWIDYHL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 84/238 (35%)
Tryp_SPc 169..405 CDD:214473 81/235 (34%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 84/238 (35%)
Tryp_SPc 39..256 CDD:214473 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.