DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG14227

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:258 Identity:69/258 - (26%)
Similarity:101/258 - (39%) Gaps:66/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCV--ESLRTGSFTVRAGEWDTQTMKERLPYQERS 239
            ||.|:::.:|...  |:||||:.:.||||||||  |:::     |..|::|...     |.|..|
  Fly    57 PWIVSVIVNGKAK--CSGSLINHRFVLTAAHCVFREAMQ-----VHLGDFDAWN-----PGQNCS 109

  Fly   240 ------------VQTVILHPDYNR-RSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTC 291
                        :...|:|..:.: ::..||..|:.:...|...|.:..|||...:  |......
  Fly   110 SGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINE--PVAAIDR 172

  Fly   292 FS-TGWGKDA--FGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKF--ALDRSFICAGGQRG 351
            |. |.||..|  |.|            :|.|..:|...|:.......||  .:|.|.||...:..
  Fly   173 FQLTVWGTTAEDFRS------------IPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETS 225

  Fly   352 IDTCQGDGGAPLACP--RGSTRESRYQQTGIVAWGIG-------CNDEVPAAYANVALVRGWI 405
             ..|:||.|.|.:..  .|.|  .|..|.||:.:|:.       |        .||.....||
  Fly   226 -HACKGDSGGPFSAKILYGGT--YRTFQFGIIIFGLSSCAGLSVC--------TNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 69/258 (27%)
Tryp_SPc 169..405 CDD:214473 67/256 (26%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 67/256 (26%)
Tryp_SPc 57..277 CDD:238113 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.