DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG4653

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:112/261 - (42%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GVSQNE---AGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCV------ESLRTGSFTVR 220
            ||.|:.   |..|..|.:::|..:|  .:.|.|:||.::.:|||||||      :|....|:.||
  Fly    22 GVVQSSRLPAEVGSQPHSISLRRNG--VHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVR 84

  Fly   221 AGEWDTQTMKERLPYQERSVQTVILHPDYNRRSI--AYDFALVILSQPVTLDDHINVICLPQQDD 283
            .|.....|..:.:|     :..:|:|.:|:....  :.|.||:.|...|.|:.:.|.|.|..:. 
  Fly    85 VGSIQRLTGGQLVP-----LSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATER- 143

  Fly   284 IPQPGNTCFSTGWGKDAF-GSLGKYSSLMKRVPLPIVEFNSCQTRLRGTR-----LGPKFALDRS 342
             |..|:....:|||.... |||.....:..|..|   ..:.|||.|...:     |.|   :|..
  Fly   144 -PAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSL---SASDCQTELYLQQEDLLCLSP---VDED 201

  Fly   343 FICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGI-GCNDEVPAAYANVALVRGWID 406
            |  ||      .|.||.|||.:        ...|..||.|:.: ||..|.|..|.:|.....||:
  Fly   202 F--AG------LCSGDAGAPAS--------YNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWIN 250

  Fly   407 Q 407
            :
  Fly   251 E 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 75/260 (29%)
Tryp_SPc 169..405 CDD:214473 71/253 (28%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/253 (29%)
Tryp_SPc 30..249 CDD:214473 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.