DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG9676

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:258 Identity:75/258 - (29%)
Similarity:113/258 - (43%) Gaps:53/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVE-----------SLRTGSFTV 219
            |...:|..|:||..::|...|  |:.|.||:|.|..|:||||||:           .::.||..:
  Fly    29 VGGTKAREGQFPHQISLRRRG--SHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91

  Fly   220 RAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDI 284
            .:|       ..|:|     |.||.:||:||  |..:|.|::.|...:|.:.:|..|.|..:|  
  Fly    92 SSG-------GVRVP-----VATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATED-- 140

  Fly   285 PQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQ-TRLRGTRLGPKFALDRSFICAGG 348
            |....|...:|||  |....|..|:.:..|.:..:...||| |.||        .|..:.:|...
  Fly   141 PPNDATVDISGWG--AISQRGPISNSLLYVQVKALSRESCQKTYLR--------QLPETTMCLLH 195

  Fly   349 QRGIDTCQGDGGAPLACPRGSTRESRYQ--QTGIVAWGI-GCNDEVPAAYANVALVRGWIDQQ 408
            .:....|.||.|.|          :.||  ..|:.::.| ||....|..|..|:.:|.||.::
  Fly   196 PKDKGACYGDSGGP----------ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 75/256 (29%)
Tryp_SPc 169..405 CDD:214473 72/250 (29%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/253 (29%)
Tryp_SPc 28..248 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.